-
HPA072309-100UL
ANTI-E4F1 ANTIBODY PRODUCED IN RABBIT (C15-1466-200)
Price: $977.14List Price: $1,085.71Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA002916-100UL
Anti-EAPP antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen E2F-associated phosphoprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA021153-100UL
Anti-EBAG9 antibody produced in rabbit (C15-1449-767)
Price: $879.43List Price: $977.14The gene EBAG9 (estrogen receptor-binding fragment-associated gene 9) is mapped to human chromosome 8q23. It is a type II transmembrane protein and is ubiquitously expressed. -
HPA021154-100UL
Anti-EBAG9 antibody produced in rabbit (C15-1449-768)
Price: $879.43List Price: $977.14The gene EBAG9 (estrogen receptor-binding fragment-associated gene 9) is mapped to human chromosome 8q23. It is a type II transmembrane protein and is ubiquitously expressed. -
HPA062510-100UL
Anti-EBLN2 antibody produced in rabbit (C15-1464-106)
Price: $928.29List Price: $1,031.43Immunogen endogenous Bornavirus-like nucleoprotein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA068795-100UL
Anti-EBLN2 antibody produced in rabbit (C15-1465-545)
Price: $928.29List Price: $1,031.43Immunogen endogenous Bornavirus-like nucleoprotein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA063337-100UL
Anti-ECSCR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to endothelial cell surface expressed chemotaxis and apoptosis regulator Sequence SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA037972-100UL
Anti-EDA antibody produced in rabbit (C15-1454-999)
Price: $928.29List Price: $1,031.43Immunogen ectodysplasin A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA037973-100UL
Anti-EDA antibody produced in rabbit (C15-1455-001)
Price: $928.29List Price: $1,031.43Immunogen ectodysplasin A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA054522-100UL
Anti-EDA2R antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ectodysplasin A2 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042292-100UL
Anti-EDAR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ectodysplasin A receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA040650-100UL
Anti-EDC3 antibody produced in rabbit (C15-1456-283)
Price: $928.29List Price: $1,031.43Immunogen enhancer of mRNA decapping 3 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project