-
Add to Cart The item has been addedHPA029612-100ULAnti-EFCAB7 antibody produced in rabbit (C15-1452-339)
Price: $879.43List Price: $977.14Immunogen EF-hand calcium binding domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA029613-100ULAnti-EFCAB7 antibody produced in rabbit (C15-1452-340)
Price: $879.43List Price: $977.14Immunogen EF-hand calcium binding domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA042751-100ULAnti-EFCAB8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen EF-hand calcium binding domain 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA035307-100ULAnti-EFHC1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen EF-hand domain (C-terminal) containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA069549-100ULANTI-EFNA1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen ephrin A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA067567-100ULAnti-EFNA2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ephrin A2 Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA022859-100ULAnti-EFR3A antibody produced in rabbit (C15-1450-154)
Price: $879.43List Price: $977.14EFR3A (EFR3 homolog A) is a plasma membrane localized protein mapped to human chromosome 8q24 region. Immunogen Protein EFR3 homolog A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA023092-100ULAnti-EFR3A antibody produced in rabbit (C15-1450-252)
Price: $879.43List Price: $977.14EFR3A (EFR3 homolog A) protein localizes at the plasma membrane. The gene is mapped to human chromosome 8q24. -
Add to Cart The item has been addedHPA023402-100ULAnti-EFR3A antibody produced in rabbit (C15-1450-392)
Price: $879.43List Price: $977.14The EFR3A (EFR3 homolog A) protein is found to be localized at the plasma membrane. The gene is mapped to human chromosome 8q24. -
Add to Cart The item has been addedHPA001581-100ULAnti-EFS antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen embryonal Fyn-associated substrate Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA001200-100ULAnti-EGFR antibody produced in rabbit (C15-1445-196)
Price: $879.43List Price: $977.14The gene epidermal growth factor receptor (EGFR) is mapped to human chromosome 7p12. It belongs to receptor tyrosine kinase family. -
Add to Cart The item has been addedHPA018530-100ULAnti-EGFR antibody produced in rabbit (C15-1449-064)
Price: $879.43List Price: $977.14The gene EGFR (epidermal growth factor receptor) is mapped to human chromosome 7p12. It belongs to receptor tyrosine kinase family.
