-
HPA021509-100UL
Anti-ENTPD8 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Ectonucleoside triphosphate diphosphohydrolase 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA019460-100UL
Anti-EOGT antibody produced in rabbit
Price: $879.43List Price: $977.14The gene EOGT (extracellular O -linked N -acetylglucosamine transferase) is mapped to human chromosome 3p14.1. -
HPA028896-100UL
Anti-EOMES antibody produced in rabbit
Price: $977.14List Price: $1,085.71Eomes (eomesodermin) is a Tâ€box transcription factor. In mRCC (metastatic renal cell cancer) patients treated with sorafenib, eomes mRNA is suggested as a prognostic marker for overall survival and progression-free survival. -
HPA003128-100UL
Anti-EP300 antibody produced in rabbit (C15-1445-799)
Price: $879.43List Price: $977.14The gene EP300 (E1A binding protein p300) is mapped to human chromosome 22q13.2. -
HPA004112-100UL
Anti-EP300 antibody produced in rabbit (C15-1446-150)
Price: $879.43List Price: $977.14Immunogen Histone acetyltransferase p300 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA016704-100UL
Anti-EP400 antibody produced in rabbit (C15-1448-578)
Price: $879.43List Price: $977.14Immunogen E1A-binding protein p400 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA049013-100UL
Anti-EP400 antibody produced in rabbit (C15-1459-787)
Price: $928.29List Price: $1,031.43Immunogen E1A binding protein p400 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA031200-100UL
Anti-EPAS1 antibody produced in rabbit (C15-1453-025)
Price: $889.20List Price: $988.00Immunogen endothelial PAS domain protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA069697-100UL
Anti-EPAS1 antibody produced in rabbit (C15-1465-726)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to endothelial PAS domain protein 1 Sequence EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA028076-100UL
Anti-EPB41 antibody produced in rabbit (C15-1451-702)
Price: $879.43List Price: $977.14Immunogen erythrocyte membrane protein band 4.1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028096-100UL
ANTI-EPB41 ANTIBODY PRODUCED IN RABBIT (C15-1451-710)
Price: $977.14List Price: $1,085.71Immunogen erythrocyte membrane protein band 4.1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028412-100UL
Anti-EPB41 antibody produced in rabbit (C15-1451-820)
Price: $879.43List Price: $977.14Immunogen erythrocyte membrane protein band 4.1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive