-
Add to Cart The item has been addedHPA040261-100ULAnti-EPB42 antibody produced in rabbit (C15-1456-129)
Price: $928.29List Price: $1,031.43Immunogen erythrocyte membrane protein band 4.2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA028931-100ULANTI-EPC1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen enhancer of polycomb homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA036759-100ULAnti-EPC2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen enhancer of polycomb homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA026761-100ULAnti-EPCAM antibody produced in rabbit
Price: $879.43List Price: $977.14Epithelial cell adhesion molecule (EpCAM) gene, also referred to as TACSTD (tumor-associated calcium signal transducer) 1, is mapped to human chromosome 2p21, a region composed of the mutS homolog 2 (MSH2) and mutS homolog 6 (MSH6) DNA mismatch -
Add to Cart The item has been addedHPA072321-100ULANTI-EPDR1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen ependymin related 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA031689-100ULAnti-EPG5 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen KIAA1632 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA014369-100ULAnti-EPGN antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen epithelial mitogen Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA067740-100ULAnti-EPHB1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen EPH receptor B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA071200-100ULAnti-EPHB2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen EPH receptor B2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA007698-100ULAnti-EPHB3 antibody produced in rabbit (C15-1446-960)
Price: $879.43List Price: $977.14Immunogen Ephrin type-B receptor 3 precursor recombinant protein epitope signature tag (PrEST) Sequence AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSE Application -
Add to Cart The item has been addedHPA008184-100ULAnti-EPHB3 antibody produced in rabbit (C15-1447-072)
Price: $879.43List Price: $977.14Ephrin type-B receptor 3 (EPHB3) belongs to the family of Eph receptor tyrosine kinases. Immunogen Ephrin type-B receptor 3 precursor recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedAV54286-100ULAnti-EPHX1 antibody produced in rabbit (C15-1341-894)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human EPHX1 Application Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL. Biochem/physiol Actions EPHX1 [Epoxide hydrolase 1,
