Sumac allergenic extracts

Immunogen Trifunctional enzyme subunit alpha, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added

Immunogen hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

HDAC8 (histone deacetylase 8) is a class I enzyme, that has 377 residue and it lies between class I and class II HDACs. It is located on X chromosome.

Immunogen Synthetic peptide directed towards the C terminal region of human HDAC9 Biochem/physiol Actions Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone

Immunogen histone deacetylase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen hdc homolog, cell cycle regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen headcase homolog ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Histone Deacetylase (HDACs) have been described as six or seven different groups in mammals. HDAC1, HDAC2 and HDAC3 are like yeast Rpd3 protein, while HDAC4, HDAC5 and HDAC6 are like yeast Hda1 (Histone Deacetylase 1) protein.

Immunogen Recombinant protein corresponding to snail family transcriptional repressor 1 Sequence SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen snail family zinc finger 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen SH3 and cysteine rich domain 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen sulfatase modifying factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are