-
HPA015536-100UL
Anti-HADHA antibody produced in rabbit (C15-1448-360)
Price: $879.43List Price: $977.14Immunogen Trifunctional enzyme subunit alpha, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies ® are highly characterized and extensively validated antibodies with the added -
HPA056070-100UL
Anti-HADHA antibody produced in rabbit (C15-1462-234)
Price: $928.29List Price: $1,031.43Immunogen hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA048560-100UL
Anti-HDAC8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43HDAC8 (histone deacetylase 8) is a class I enzyme, that has 377 residue and it lies between class I and class II HDACs. It is located on X chromosome. -
AV42788-100UL
Anti-HDAC9 antibody produced in rabbit (C15-1341-419)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human HDAC9 Biochem/physiol Actions Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone -
HPA028926-100UL
Anti-HDAC9 antibody produced in rabbit (C15-1452-057)
Price: $879.43List Price: $977.14Immunogen histone deacetylase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA012581-100UL
ANTI-HECA ANTIBODY PRODUCED IN RABBIT (C15-1447-803)
Price: $977.14List Price: $1,085.71Immunogen hdc homolog, cell cycle regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA042313-100UL
Anti-HECA antibody produced in rabbit (C15-1457-158)
Price: $928.29List Price: $1,031.43Immunogen headcase homolog ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
H3159-.2ML
Anti-Histone Deacetylase 2 (HDAC2) antibody produced in rabbit
Price: $841.71List Price: $935.24Histone Deacetylase (HDACs) have been described as six or seven different groups in mammals. HDAC1, HDAC2 and HDAC3 are like yeast Rpd3 protein, while HDAC4, HDAC5 and HDAC6 are like yeast Hda1 (Histone Deacetylase 1) protein. -
HPA056831-100UL
Anti-SNAI1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to snail family transcriptional repressor 1 Sequence SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA071127-100UL
Anti-SNAI3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen snail family zinc finger 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA039285-100UL
Anti-STAC3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SH3 and cysteine rich domain 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA038025-100UL
Anti-SUMF1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sulfatase modifying factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are