-
HPA021012-100UL
Anti-ATIC antibody produced in rabbit
Price: $879.43List Price: $977.14The gene ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) is mapped to human chromosome 2q35. Immunogen Bifunctional purine biosynthesis protein PURH recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA051353-100UL
Anti-ATRAID antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 2 open reading frame 28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA042575-100UL
Anti-ENHO antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen energy homeostasis associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA046917-100UL
Anti-HEATR1 antibody produced in rabbit (C15-1459-053)
Price: $928.29List Price: $1,031.43Immunogen HEAT repeat containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA062200-100UL
Anti-HEATR1 antibody produced in rabbit (C15-1464-015)
Price: $928.29List Price: $1,031.43Immunogen HEAT repeat containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059840-100UL
Anti-LYRM1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen LYR motif containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA019545-100UL
Anti-PARL antibody produced in rabbit
Price: $879.43List Price: $977.14PARL (Presenilin associated, rhomboid-like) is a nuclear modifier gene expressed in both outer and inner mitochondrial membranes. Immunogen presenilin associated rhomboid like recombinant protein epitope signature tag (PrEST) Application All -
HPA039109-100UL
Anti-RSPH3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen radial spoke 3 homolog ( chlamydomonas ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058992-100UL
Anti-RSRP1 antibody produced in rabbit (C15-1463-111)
Price: $928.29List Price: $1,031.43Immunogen arginine/serine-rich protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA067651-100UL
Anti-RSRP1 antibody produced in rabbit (C15-1465-349)
Price: $928.29List Price: $1,031.43Immunogen arginine/serine-rich protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA062793-100UL
Anti-SPSB4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to splA/ryanodine receptor domain and SOCS box containing 4 Sequence QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA000175-100UL
Anti-SYAP1 antibody produced in rabbit (C15-1444-885)
Price: $879.43List Price: $977.14Immunogen Synapse-associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are