Tumor polypeptide antigen (tpa - incl. tps) tests

Immunogen Purkinje cell protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Purkinje cell protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The gene PCTP (phosphatidylcholine transfer protein) is mapped to human chromosome 17q21-22. It belongs to the steroidogenic acute regulatory protein related transfer (START) domain superfamily.

Human MCP-1 is a chemokine assoscited with the attraction of Monocytes and Basophils to the site of a pathology. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and

Cell Line Origin Human T cell lymphoma Cell Line Description Derived from peripheral blood of a 50 year old male patient with Sezary syndrome. Cells exhibit the features of a mature T cell line with inducer/helper phenotype.

Immunogen Recombinant protein corresponding to Purkinje cell protein 4 Sequence GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK Epitope Binds to an epitope located within the peptide sequence RAAVAIQSQFRKFQK as determined by overlapping

Recombinant protein fragment of Human AIMP1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human AMBP with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

N-terminal His 6 ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Application Suitable as a blocking agent and positive assay control using corresponding antibodies. Linkage Corresponding Antibodies HPA075585 Physical form

PrEST Antigen BTLA B and T lymphocyte associated, 100ul UN 1

Recombinant protein fragment of Human CADPS with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human CCP110 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.