-
Add to Cart The item has been addedA659408-10mgALX 40-4C Trifluoroacetate (C007B-326688)
Price: $1,325.55List Price: $1,472.84ALX 40-4C Trifluoroacetate is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1: ALX 40-4C Trifluoroacetate also acts as an -
Add to Cart The item has been addedA659408-1mgALX 40-4C Trifluoroacetate (C007B-326689)
Price: $288.15List Price: $320.17ALX 40-4C Trifluoroacetate is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1: ALX 40-4C Trifluoroacetate also acts as an -
Add to Cart The item has been addedA659408-5mgALX 40-4C Trifluoroacetate (C007B-326690)
Price: $811.09List Price: $901.22ALX 40-4C Trifluoroacetate is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1: ALX 40-4C Trifluoroacetate also acts as an -
Add to Cart The item has been addedZ740188-96EAAMICON(R) ULTRA-4 PLBC ULTRACEL-3 MEMBRANE 3 KDA 96
Price: $1,167.57List Price: $1,297.30AMICON(R) ULTRA-4 PLBC ULTRACEL-3 MEMBRANE 3 KDA 96 -
Add to Cart The item has been addedHPA023386-25Anti-BAHCC1 BAH domain and coiled-coil containing 1, 25ul UN (C003B-056093)
Price: $588.44List Price: $653.82Anti-BAHCC1 BAH domain and coiled-coil containing 1, 25ul UN -
Add to Cart The item has been addedHPA055196-25Anti-CDX1 caudal type homeobox 1, 25ul UN 1687 6.1 PG2
Price: $588.44List Price: $653.82Anti-CDX1 caudal type homeobox 1, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAMAb91827-100Anti-CDX2 Caudal type homeobox 2, 100ul UN 1687 6.1 PG2 (C003B-071865)
Price: $888.55List Price: $987.28Anti-CDX2 Caudal type homeobox 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAMAb91828-100Anti-CDX2 Caudal type homeobox 2, 100ul UN 1687 6.1 PG2 (C003B-071866)
Price: $888.55List Price: $987.28Anti-CDX2 Caudal type homeobox 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA045669-100Anti-CDX2 caudal type homeobox 2, 100ul UN 1687 6.1 PG2 (C003B-083762)
Price: $888.55List Price: $987.28Anti-CDX2 caudal type homeobox 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA049580-100Anti-CDX2 caudal type homeobox 2, 100ul UN 1687 6.1 PG2 (C003B-085049)
Price: $888.55List Price: $987.28Anti-CDX2 caudal type homeobox 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedSAB2108962-100ULANTI-CEMP1 (C-TERMINAL) ANTIBODY PRODUCED IN RABBIT
Price: $785.86List Price: $873.18Immunogen Synthetic peptide directed towards the C-terminal region of Human CEMP1 Sequence Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI Physical form Supplied at 0.5 mg/ml in -
Add to Cart The item has been addedSAB2108963-100ULANTI-CEMP1 (C-TERMINAL) ANTIBODY PRODUCED IN RABBIT BIOTIN CONJUGATED
Price: $834.51List Price: $927.23Immunogen Synthetic peptide directed towards the C-terminal region of Human CEMP1 Sequence Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI Physical form Supplied at 0.5 mg/ml in
