Third generation cephalosporins

A dual-chamber IV container now available in five cephalosporins that cover three generations of treatment. Conveniently activated at point of care, there is no need for freezing or special vials. Pre-filled drug and diluent chambers eliminate need

CellTrol Drive Stem Specifications: Bioreactor Size: 3 to 7L

Chemical structure: ß-lactam Application 7-Aminocephalosporanic acid (7-ACA) can be used as a starting material to synthesize: Cefotaxime by acylation reaction with S -benzothiazol-2-yl(2-amino-4-thiazolyl)(methoxyimino)thioacetate (MAEM) in the

Immunogen The immunogen for anti-CES3 antibody: synthetic peptide derected towards the C terminal of human CES3 Sequence Synthetic peptide located within the following region: QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQKQKNRKAQEDL Physical form

Anti-SPCS3 signal peptidase complex subunit 3 homolog (S. ce

TRIOBP (TRIO and F-actin binding protein) is a putative cytoskeleton-associated protein localized to hair cell stereocilia rootlets. It is located to chromosome 22q13.

Anti-TYW3 tRNA-yW synthesizing protein 3 homolog (S. cerevis

Anti-TYW3 tRNA-yW synthesizing protein 3 homolog (S. cerevis

Application：δ-3 Cefeclor (Cefaclor EP Impurity D) is an isomer of Cefaclor, a second-generation cephalosporin antibiotic. Antibacterial.

Application：δ-3 Cefeclor (Cefaclor EP Impurity D) is an isomer of Cefaclor, a second-generation cephalosporin antibiotic. Antibacterial.

&#955 phage for delivery of T7 RNA polymerase Bacteriophage CE6 is a recombinant lambda phage containing the T7 RNA polymerase gene (Studier 1986). The polymerase gene is cloned into the int gene, such that it is transcribed from the p L and p I

&#955 phage for delivery of T7 RNA polymerase Bacteriophage CE6 is a recombinant lambda phage containing the T7 RNA polymerase gene (Studier 1986). The polymerase gene is cloned into the int gene, such that it is transcribed from the p L and p I