Epinastine hydrochloride

General description Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are diagnosed at birth or in

General description Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can

General description Members of the band 4.1 protein superfamily, including EPB41L4A, are thought to regulate the interaction between the cytoskeleton and plasma membrane (Ishiguro et al.

EGFR-IN-11 is a fourth-generation EGFR -tyrosine kinase inhibitor ( EGFR-TKI ) with an IC 50 of 18 nM for triple mutant EGFR L858R/T790M/C797S . EGFR-IN-11 significantly suppresses the EGFR phosphorylation, induce the apoptosis , and arrest cell

EGFR-IN-11 is a fourth-generation EGFR -tyrosine kinase inhibitor ( EGFR-TKI ) with an IC 50 of 18 nM for triple mutant EGFR L858R/T790M/C797S . EGFR-IN-11 significantly suppresses the EGFR phosphorylation, induce the apoptosis , and arrest cell

EGFR-IN-11 is a fourth-generation EGFR -tyrosine kinase inhibitor ( EGFR-TKI ) with an IC 50 of 18 nM for triple mutant EGFR L858R/T790M/C797S . EGFR-IN-11 significantly suppresses the EGFR phosphorylation, induce the apoptosis , and arrest cell

EGFR-IN-11 is a fourth-generation EGFR -tyrosine kinase inhibitor ( EGFR-TKI ) with an IC 50 of 18 nM for triple mutant EGFR L858R/T790M/C797S . EGFR-IN-11 significantly suppresses the EGFR phosphorylation, induce the apoptosis , and arrest cell

The racemic mixture of a cell-permeable adenine derivative that acts as a PDE II-selective phosphodiesterase inhibitor (IC 50 = 0.8 and 2 &#181M against human and procine PDE II, respectively) and adenosine deaminase (K i = 4 nM), while exhibiting

Aladdin's Endogenous Peroxidase Blocking Buffer can be used to block endogenous peroxidase in cells or tissues in Immunohistochemistry (IHC), Immunocytochemistry (ICC) and in situ Hybridization (ISH) assays.Endogenous peroxidase is widely present in

Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF) To be used in conjunction with Cayman&rsquos EP1 receptor polyclonal antibody (Catalog No. 101740) to block protein-antibody complex formation during

Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF) To be used in conjunction with Cayman&rsquos EP3 receptor polyclonal antibody (Catalog No. 101760) to block protein-antibody complex formation during

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) To be used in conjunction with Cayman&rsquos EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during