-
Add to Cart The item has been addedHPA035443-100Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 (C003B-079495)
Price: $1,108.10List Price: $1,231.23Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA035444-100Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 (C003B-079496)
Price: $1,108.10List Price: $1,231.23Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA028956-100ULANTI-CETN1 (C005B-207721)
Price: $959.88List Price: $1,066.53Immunogen centrin, EF-hand protein, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedSAB1405607-50UGANTI-CETN1 (C005B-336506)
Price: $980.46List Price: $1,089.40General description The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase -
Add to Cart The item has been addedHPA063704-100ULANTI-CETN3 (C005B-219713)
Price: $1,013.20List Price: $1,125.78Immunogen centrin, EF-hand protein, 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA066046-100ULANTI-CLN6 ANTIBODY PRODUCED IN RABBIT (C005B-220258)
Price: $1,013.20List Price: $1,125.78Immunogen ceroid-lipofuscinosis, neuronal 6, late infantile, variant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA074162-100ULANTI-CLN6 (C005B-221731)
Price: $1,013.20List Price: $1,125.78Immunogen ceroid-lipofuscinosis, neuronal 6, late infantile, variant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA075795-100ULANTI-CLTCL1 (C005B-221986)
Price: $1,013.20List Price: $1,125.78Immunogen clathrin, heavy chain-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA049657-100ULANTI-MTHFD2 ANTIBODY PRODUCED IN RABBIT (C005B-215406)
Price: $1,013.20List Price: $1,125.78Immunogen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA038625-100ULANTI-PCDHGA2 (C005B-210878)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to protocadherin gamma subfamily A, 2 Sequence ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA054218-100ULANTI-PDE4C ANTIBODY PRODUCED IN RABBIT (C005B-216947)
Price: $1,066.53List Price: $1,185.03Immunogen phosphodiesterase 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedSAB2500766-100UGANTI-PDE4D3 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence HVNNFPFRRHS-C from the N Terminus of the protein sequence according to AAA97892.1.
