-
HPA064699-100Anti-CERK ceramide kinase, 100ul UN 1687 6.1 PG2
Price: $2,082.66List Price: $2,314.07Anti-CERK ceramide kinase, 100ul UN 1687 6.1 PG2 -
HPA035443-100Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 (C003B-079495)
Price: $1,840.19List Price: $2,044.65Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 -
HPA035444-100Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 (C003B-079496)
Price: $1,840.19List Price: $2,044.65Anti-CERKL ceramide kinase-like, 100ul UN 1687 6.1 PG2 -
HPA028956-100ULANTI-CETN1 (C005B-207721)
Price: $1,210.58List Price: $1,345.09Immunogen centrin, EF-hand protein, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA063704-100ULANTI-CETN3 (C005B-219713)
Price: $1,210.58List Price: $1,345.09Immunogen centrin, EF-hand protein, 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA066046-100ULANTI-CLN6 ANTIBODY PRODUCED IN RABBIT (C005B-220258)
Price: $1,210.58List Price: $1,345.09Immunogen ceroid-lipofuscinosis, neuronal 6, late infantile, variant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA074162-100ULANTI-CLN6 (C005B-221731)
Price: $1,210.58List Price: $1,345.09Immunogen ceroid-lipofuscinosis, neuronal 6, late infantile, variant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA075795-100ULANTI-CLTCL1 (C005B-221986)
Price: $1,210.58List Price: $1,345.09Immunogen clathrin, heavy chain-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049657-100ULANTI-MTHFD2 ANTIBODY PRODUCED IN RABBIT (C005B-215406)
Price: $1,210.58List Price: $1,345.09Immunogen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA038625-100ULANTI-PCDHGA2 (C005B-210878)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to protocadherin gamma subfamily A, 2 Sequence ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA054218-100ULANTI-PDE4C ANTIBODY PRODUCED IN RABBIT (C005B-216947)
Price: $1,210.58List Price: $1,345.09Immunogen phosphodiesterase 4C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038638-100ULANTI-TCHP (C005B-210882)
Price: $1,210.58List Price: $1,345.09Trichoplein (TCHP) is also termed as mitostatin (TpMs). It is a keratin binding protein, which is partly located in the mitochondria.
Cemadotin
Browse our curated selection of Cemadotin from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
About Cemadotin
Cenmed Enterprises provides a comprehensive selection of Cemadotin products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.



