Nedaplatin

Immunogen Synthetic peptide directed towards the middle region of human LYRM4 Sequence Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI Physical form Purified antibody supplied in 1x

Anti-MAB21L3 mab-21-like 3 (C. elegans), 25ul UN 1687 6.1 PG

General description Merlin (UniProt P35240: also known as Moesin-ezrin-radixin-like protein, Neurofibromin-2, Schwannomerlin, Schwannomin) is encoded by the NF2 (also known as SCH) gene (Gene ID 4771) in human. Originally identified as a tumor

Immunogen Synthetic peptide directed towards the C terminal region of human MTA3 Biochem/physiol Actions MTA3 plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone

General description Phosphorylation plays an important role in regulating protein activities and various cellular signaling events in cells. Limited by the tools available for phosphohistidine (pHis) detection, the majority of studies focus on

General description Phosphorylation plays an important role in regulating protein activities and various cellular signaling events in cells. Limited by the tools available for phosphohistidine (pHis) detection, the majority of studies focus on

ANTI-NEDD4 ANTIBODY CLONE 7R0M4 RABBIT MONOCLONAL

Anti-NEO1 neogenin 1, 100ul UN 1687 6.1 PG2

Anti-NEO1 neogenin 1, 100ul UN 1687 6.1 PG2

Anti-NEO1 neogenin 1, 100ul UN 1687 6.1 PG2

Anti-NETO1 neuropilin (NRP) and tolloid (TLL)-like 1, 100ul

Anti-NETO1 neuropilin (NRP) and tolloid (TLL)-like 1, 25ul U