Antiviral peptides

Application This cis -aminoindanol and its antipode have been used in the preparation of a series of potent HIV-1 protease inhibitory peptides. Also, they have served as chiral ligands in the catalytic asymmetric reduction of prochiral ketones with

Application This cis -aminoindanol and its antipode have been used in the preparation of a series of potent HIV-1 protease inhibitory peptides. Also, they have served as chiral ligands in the catalytic asymmetric reduction of prochiral ketones with

6'-Amino-D-luciferin

Amino Acid Sequence Ac-Gln-Lys-Leu-Val-Phe-Phe-NH2 General description Amyloid plaques characteristic of the Alzheimer brain contain fibrils composed of amyloid &#946: aggregates. Peptides, small organic molecules and nanoparticles can be used

General description 2A peptides and 2A-like peptide sequences (known as cis-acting hydrolase elements or CHYSEL) are a superior alternative to internal ribosomal entry sites (IRES) for coordinating the expression of multiple gene products from a

General description Capsid protein VP1 (UniProt: Q6JC40) is encoded by the Cap gene in Adeno-associated virus 9 (AAV9). Adeno-associated viruses (AAV) are small non-enveloped DNA viruses that can serve as promising viral vectors for gene delivery,

General description Capsid protein VP1 (UniProt: Q6JC40) is encoded by the Cap gene in Adeno-associated virus 9 (AAV9). Adeno-associated viruses (AAV) are small non-enveloped DNA viruses that can serve as promising viral vectors for gene delivery,

HIV and related viruses require coreceptors, in addition to CD4, to infect target cells. Some G-protein-coupled receptors including CCR5, CXCR4, CCR3, CCR2b and CCR8 in the chemokine receptor family, and four new human molecules GPR15, STRL33, GPR1

C14ORF166 (CLE) is known to interact with influenza virus polymerase and HCV (Hepatitis C Virus) core protein during viral replication and assembly. Rabbit Anti-C14ORF166 antibody recognizes bovine, human, mouse, rat, and canine C14ORF166.

Immunogen Synthetic peptide directed towards the N terminal of human C1QL1 Sequence Synthetic peptide located within the following region: MLLVLVVLIPVLVSSGGPDGHYEMLGTCRMVCDPYPARGPGAGARSDGGD Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human CAMKV Sequence Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF Physical form Purified antibody supplied in

Anti-CCHCR1 coiled-coil alpha-helical rod protein 1, 100ul U