Antiviral peptides

Anti-SPPL3 signal peptide peptidase like 3, 100ul UN 1687 6.

Anti-SPPL3 signal peptide peptidase like 3, 100ul UN 1687 6.

Anti-SPPL3 signal peptide peptidase like 3, 25ul UN 1687 6.1

Anti-SPPL3 signal peptide peptidase like 3, 25ul UN 1687 6.1

Immunogen Synthetic peptide directed towards the middle region of human TRIM59 Sequence Synthetic peptide located within the following region: LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence C-RSLVKPENYRRLD from the internal region of the protein sequence according to NP_000542.1: NP_937799.

Immunogen Peptide with sequence C-DDVKVERIEYKKP from the C Terminus of the protein sequence according to NP_057310.1: NP_476528.

Anti-West Nile Virus Matrix Antibody has been tested for use in ELISA. Specific conditions for reactivity should be optimized by the end user. Expect a band at approximately 380 kDa in Western Blots of specific cell lysates and tissues.

General description HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the

Designed for the analysis of larger proteins and peptides, Thermo Scientificâ„¢ BioBasicâ„¢ 4 LC Columns are high-performance columns ideal for the analysis of proteins, peptides and other biomolecules with high hydrophobicity.

Designed for the analysis of larger proteins and peptides, Thermo Scientificâ„¢ BioBasicâ„¢ 4 LC Columns are high-performance columns ideal for the analysis of proteins, peptides and other biomolecules with high hydrophobicity.

Designed for the analysis of larger proteins and peptides, Thermo Scientificâ„¢ BioBasicâ„¢ 4 LC Columns are high-performance columns ideal for the analysis of proteins, peptides and other biomolecules with high hydrophobicity.