Vidarabine phosphate

Immunogen The antiserum was produced against synthesized peptide derived from human p53 around the phosphorylation site of Thr18. Immunogen Range: 1-50 Features and Benefits Evaluate our antibodies with complete peace of mind.

General description SRC (proto-oncogene, non-receptor tyrosine kinase) belongs to the Src family kinases (SFKs). It contains an amino-terminal domain, conserved Src-homology domains (SH2 and SH3), a tyrosine kinase domain and the carboxyl-terminus.

Tyrosine-protein kinase Syk (EC 2.7.

PNKP (Polynucleotide kinase 3&#8242-phosphatase) is a 57.1kDa, DNA repair protein.

Immunogen protein phosphatase 1, catalytic subunit, alpha isozyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen protein phosphatase 2, catalytic subunit, alpha isozyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

PSTPIP1 (proline-serine-threonine phosphatase interacting protein 1) is a cytoskeleton-associated adaptor protein, which contains an F-BAR (bin-amphiphysin-Rvs) domain. It shares high homology to PSTPIP2 protein, and is composed of an N-terminal

Immunogen Recombinant protein corresponding to pseudouridine 5&#8242-phosphatase Sequence LVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGEPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPD Application All Prestige

Immunogen Periodic tryptophan protein 2 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

General description Rsk1, Rsk2, and Rsk3 (ribosomal protein S6 kinase, 90kDa, polypeptide 1,2,3: S6K-alpha 1,2,3) are Ser/Thr kinases which are activated by MAP Kinases, and are alternatively referred to as MAPKAP kinases 1a, 1b, and 1c. Following

Anti-SBK3 SH3 domain binding kinase family member 3, 100ul U

SH2B3 (SH2B adaptor protein 3) is a part of adaptor family of proteins, which are characterized by a conserved tyrosine residue at the C-terminal, an Src homology-2 domain (SH2), a pleckstrin homology domain (PH) and a proline-rich dimerization