Centrophenoxine or meclofenoxate

Anti-MANF mesencephalic astrocyte-derived neurotrophic facto

MEF2C (myocyte enhancer factor 2C) belongs to Myocyte enhancer factor 2 (MEF2) protein family, which in turn belongs to a family of transcriptional regulators called MADS (MCMI, agamous, deficiens, serum response factor)-box. Four different forms

Immunogen Synthetic peptide directed towards the middle region of human MEF2C Sequence Synthetic peptide located within the following region: PPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRY Disclaimer Unless otherwise stated in our catalog

Immunogen Synthetic peptide directed towards the C terminal region of human MFN2 Biochem/physiol Actions MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the

General description Mitochondria are essential organelles whose function is critical to homeostasis, energy generation, and cell fate. Their dysfunction leads to various human diseases.

General description Mitochondria are essential organelles whose function is critical to homeostasis, energy generation, and cell fate. Their dysfunction leads to various human diseases.

General description Anti-Mitofusin 2 is produced in rabbit using as immunogen a synthetic peptide corresponding to human mitofusin 2 with an N-terminal added cysteine, conjugated to KLH. Mitofusins (Mfn1 and Mfn2) form homotypic and heterotypic

Specificity Reactive with human brain NOS-I (nNOS). Antibody binding is neutralized in Western blot by pre-adsorption with the immunogen peptide.

General description Serotonin/5-HT (5-hydroxytryptamine) is a neurotransmitters present in the brain. Anti-Serotonin specifically stains enterochromaffin cells in formalin-fixed, paraffin-embedded sections of normal human appendix and

General description Serotonin/5-HT (5-hydroxytryptamine) is a neurotransmitters present in the brain. Anti-Serotonin specifically stains enterochromaffin cells in formalin-fixed, paraffin-embedded sections of normal human appendix and

General description Serotonin/5-HT (5-hydroxytryptamine) is a neurotransmitters present in the brain. Anti-Serotonin specifically stains enterochromaffin cells in formalin-fixed, paraffin-embedded sections of normal human appendix and

General description Vimentin is a class III intermediate filament protein (homopolymers) found in various non-epithelial cells including mesenchymal cells and fibroblasts. In many cells of mesenchymal origin, it is one of the most prominent