Amylase/papain

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

Maleimide PEG acid (Maleimide-PEG-COOH) is a thiol reactive heterobifunctional PEG derivative. Maleimide groups react with sulfhydryl groups at pH 6.5~7.5 at room temperature to form stable thioether bonds, while carboxylic acid groups on the other

InformationMK-8617 MK-8617 is an orally active pan-inhibitor of Hypoxia-inducible factor prolyl hydroxylase 1−3 (HIF PHD1−3), inhibiting PHD1 , 2 , 3 with IC50s of 1.0, 1.0 and 14 nM, respectively.TargetsPHD1 (Cell-free assay): PHD2 (Cell-free

Immunogen Recombinant protein corresponding to Acyl-CoA synthetase long-chain family member 5. Sequence VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK Epitope Binds to an epitope located within

General description Aldo-keto reductases, such as AKR7A2, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM Immunogen AKR7A2 (AAH10852.

General description Monoclonal Anti- &#945:-Amylase 1A (mouse IgG1 isotype) is derived from the hybridoma AMY-7 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with an N-terminal His-tagged recombinant