Atropine/difenoxin

General description PREX2 functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol 3,4,5-trisphosphate and the

Pyrin (UniProt: O15553 also known as Marenostrin) is encoded by the MEFV (also known as MEF, TRIM20) gene (Gene ID: 4210) in human. Pyrin is a homotrimeric protein that is involved in the regulation of innate immunity and the inflammatory response

Pyrin (UniProt: O15553 also known as Marenostrin) is encoded by the MEFV (also known as MEF, TRIM20) gene (Gene ID: 4210) in human. Pyrin is a homotrimeric protein that is involved in the regulation of innate immunity and the inflammatory response

SET domain-containing protein 5 (UniProt: Q9C0A6 also known as Setd5) is encoded by the SETD5 (also known as KIAA1757) gene (Gene ID: 55209) in human. Setd5 protein is shown to be essential for mammalian development and is required for regulating

General description Junctional adhesion molecule A (UniProt: Q9Y624: also known as JAM-A, Junctional adhesion molecule 1, JAM-1, Platelet F11 receptor, Platelet adhesion molecule 1, PAM-1, CD321) is encoded by the F11R (also known as JAM1, JCAM)

General description Junctional adhesion molecule A (UniProt: Q9Y624: also known as JAM-A, Junctional adhesion molecule 1, JAM-1, Platelet F11 receptor, Platelet adhesion molecule 1, PAM-1, CD321) is encoded by the F11R (also known as JAM1, JCAM)

Anti-TFE3 Transcription factor binding to ighm enhancer 3, 1

General description This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at

TRIM17 (Terf) is an E3 ubiquitin ligase that mediates Mcl-1 degradation and initiates apoptosis in neurons. Terf can also facilitate the degradation of ZWINT (a kinetochore protein) and decrease the proliferation of MCF7 breast cancer cells.

Immunogen Synthetic peptide directed towards the middle region of human UMODL1 Sequence Synthetic peptide located within the following region: EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN Physical form Purified antibody supplied in 1x

AntiHum Clusterin,Aff Purif,(Poly,Rabbit IgG)100ug

PRIMA-1Met restores wild-type conformation and function to mutant p53, and triggers apoptosis in tumor cells. PRIMA-1Met also targets the selenoprotein thioredoxin reductase 1 (TrxR1), a key regulator of cellular redox balance.