-
Add to Cart The item has been addedHPA036260-25Anti-CDH16 cadherin 16, KSP-cadherin, 25ul UN 1687 6.1 PG2
Price: $588.44List Price: $653.82Anti-CDH16 cadherin 16, KSP-cadherin, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA026556-100Anti-CDH17 cadherin 17, LI cadherin (liver-intestine), 100ul (C003B-077095)
Price: $1,108.10List Price: $1,231.23Anti-CDH17 cadherin 17, LI cadherin (liver-intestine), 100ul -
Add to Cart The item has been addedHPA026556-25Anti-CDH17 cadherin 17, LI cadherin (liver-intestine), 25ul (C003B-056694)
Price: $588.44List Price: $653.82Anti-CDH17 cadherin 17, LI cadherin (liver-intestine), 25ul -
Add to Cart The item has been addedHPA001767-100Anti-CDH3 cadherin 3, type 1, P-cadherin (placental), 100ul
Price: $1,045.96List Price: $1,162.18Anti-CDH3 cadherin 3, type 1, P-cadherin (placental), 100ul -
Add to Cart The item has been addedHPA001767-25Anti-CDH3 cadherin 3, type 1, P-cadherin (placental), 25ul U
Price: $745.62List Price: $828.46Anti-CDH3 cadherin 3, type 1, P-cadherin (placental), 25ul U -
Add to Cart The item has been addedHPA014908-100Anti-CDH8 cadherin 8, type 2, 100ul UN 1687 6.1 PG2
Price: $1,108.10List Price: $1,231.23Anti-CDH8 cadherin 8, type 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedMABF2791-25UGANTI-DENGUE VIRUS 2 NS1. CLONE 164 (C005B-450236)
Price: $316.33List Price: $351.48General description C-C chemokine receptor type 9 (UniProt: Q9WUT7: also known as C-C CKR-9, CC-CKR-9, CCR-9, Chemokine C-C receptor 10, CDw199) is encoded by the Crr9 (also known as Cmkbr10) gene (Gene ID: 12769) in murine species. CCR9 is a -
Add to Cart The item has been addedMABF2791-100UGANTI-DENGUE VIRUS 2 NS1. CLONE 164 (C005B-450237)
Price: $753.21List Price: $836.90General description C-C chemokine receptor type 9 (UniProt: Q9WUT7: also known as C-C CKR-9, CC-CKR-9, CCR-9, Chemokine C-C receptor 10, CDw199) is encoded by the Crr9 (also known as Cmkbr10) gene (Gene ID: 12769) in murine species. CCR9 is a -
Add to Cart The item has been addedHPA039207-25Anti-FUOM fucose mutarotase, 25ul UN 1687 6.1 PG2
Price: $830.56List Price: $922.85Anti-FUOM fucose mutarotase, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedSAB2101306-100ULANTI-KRT7 (C005B-331555)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human KRT7 Sequence Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA042703-25Anti-PKIG protein kinase (cAMP-dependent, catalytic) inhibit (C003B-062191)
Price: $588.44List Price: $653.82Anti-PKIG protein kinase (cAMP-dependent, catalytic) inhibit -
Add to Cart The item has been addedHPA063690-25Anti-PKIG protein kinase (cAMP-dependent, catalytic) inhibit (C003B-068656)
Price: $588.44List Price: $653.82Anti-PKIG protein kinase (cAMP-dependent, catalytic) inhibit
