Bismuth subsalicylate/salicylic acid/sodium s

Anti-ANAPC4 anaphase promoting complex subunit 4, 100ul UN 1

Anti-ANAPC4 anaphase promoting complex subunit 4, 25ul UN 16

Anti-ANAPC4 anaphase promoting complex subunit 4, 25ul UN 16

Anti-ANAPC5 anaphase promoting complex subunit 5, 25ul UN 16

Immunogen Synthetic peptide directed towards the N terminal region of human ARC Biochem/physiol Actions ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors

Immunogen Synthetic peptide directed towards the middle region of human KIAA0226 Sequence Synthetic peptide located within the following region: DQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the N terminal region of human KIAA0427 Sequence Synthetic peptide located within the following region: SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL Physical form Purified antibody supplied

General description KIAA1199 is an endonuclear protein secreted into the extracellular environment. It encodes a 150kDa, inner ear-specific protein consisting of three domains and an N-terminal secretion signal.

Anti-NAA16 N(alpha)-acetyltransferase 16, NatA auxiliary sub

General description This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth.

General description This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved

Anti-ROPN1B rhophilin associated tail protein 1B, 100ul UN 1