Eltrombopag

Immunogen Synthetic peptide directed towards the middle region of human ELP2 Sequence Synthetic peptide located within the following region: EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT Physical form Purified antibody supplied in 1x PBS

Anti-SEBOX SEBOX homeobox, 25ul UN 1687 6.1 PG2

Elemicin.

Eltrombopag is a member of the biarylhydrazone class, which is a nonpeptide agonist of the thrombopoietin receptor (TpoR).An agonist of the thrombopoietin receptor.

Eltrombopag is a member of the biarylhydrazone class, which is a nonpeptide agonist of the thrombopoietin receptor (TpoR).An agonist of the thrombopoietin receptor.

Eltrombopag is a member of the biarylhydrazone class, which is a nonpeptide agonist of the thrombopoietin receptor (TpoR).An agonist of the thrombopoietin receptor.

Eltrombopag is a member of the biarylhydrazone class, which is a nonpeptide agonist of the thrombopoietin receptor (TpoR).An agonist of the thrombopoietin receptor.

An ELISA kit for the detection of Eln (Rat). This uses Sandwich ELISA, Double Antibody and has a sensitivity of 0.375ng/ml.

PCB LFT EX HiCap

5 x 30mm ESHMUNO &#174 Features and Benefits Eshmuno &#174 A chromatography resin enables users to: Intensify processes resulting in High Binding Capacity, Superior Flow Capability, and Excellent HCP reduction. Determine the products purity with

5 x 10 mm Features and Benefits Eshmuno &#174 HCX chromatography resin enables: Greater capacity at high-salt concentrations Superior productivity Outstanding selectivity Rigid base beads for easy packing Excellent pressure-flow behavior Strong

5 x 30 mm Features and Benefits Eshmuno &#174 HCX chromatography resin enables: Greater capacity at high-salt concentrations Superior productivity Outstanding selectivity Rigid base beads for easy packing Excellent pressure-flow behavior Strong