Glimepiride/rosiglitazone

Anti-GSTCD glutathione S-transferase, C-terminal domain cont

Anti-GSTM3 glutathione S-transferase mu 3 (brain), 100ul UN

Anti-GSTM3 glutathione S-transferase mu 3 (brain), 25ul UN 1

General description GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). Sequence Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM Physical form Supplied at

General description GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). Sequence Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM Physical form Supplied at

General description GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). Sequence Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM Physical form Supplied at

Immunogen Synthetic peptide directed towards the middle region of human PSMB5 Sequence Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ Physical form Purified antibody supplied in 1x

Anti-SLC6A9 solute carrier family 6 (neurotransmitter transp

Anti-STRADA STE20-related kinase adaptor alpha, 25ul UN 1687

Aramisulpride is a dopamine D2 receptor and serotonin receptor antagonist used for the research of metabolic disorders.Form:Solid.

Aramisulpride is a dopamine D2 receptor and serotonin receptor antagonist used for the research of metabolic disorders.Form:Solid.

Aramisulpride is a dopamine D2 receptor and serotonin receptor antagonist used for the research of metabolic disorders.Form:Solid.