Pramlintide

12&QUOT: SEC PRT -200/420C W/B

ANTI-PARKIN CLONE PRK8 100 Y56

ANTI-PARKIN CLONE PRK8 25 Y56

Immunogen Peptide sequence around phosphorylation site of threonine 2609 (V-E-T(p)-Q-A), according to the protein PRKDC. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description STAT2 (signal transducer and activator of transcription 2) is mapped to human chromosome 12. Signal transducer and activator of transcription 2 (STAT2) belongs to the STAT family.

Plakophilin 2 (Pkp2) is an armadillo-repeat protein of the cardiac desmosome. The armadillo-repeat proteins contain ten 42–amino acid armadillo-repeat motifs.

Immunogen Immunogen Sequence: GI # 4826930 , sequence 1-110 Recombinant peroxisome proliferative activated receptor gamma, isoform 1 Application Anti-PPAR&#947 antibody produced in chicken is suitable for western blotting analysis at a dilution of

Anti-PRAF2 PRA1 domain family, member 2, 100ul UN 1687 6.1 P

Immunogen Synthetic peptide directed towards the middle region of human PRDM1 Sequence Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES Physical form Purified antibody supplied in 1x

Anti-PRDM11 PR domain containing 11, 100ul UN 1687 6.1 PG2

PR domain proteins (PRDM) are a small family of kruppel-like zinc finger transcription factors involved in cell differentiation and tumorigenesis. PR domain containing 12 (PRDM12) is a putative tumor suppressor that may be implicated in poor

Prdm13 is a histone methyltransferase that belongs to the Ptf1a synexpression group. It forms an important part of the Ptf1a pathway that regulates the balance between GABAergic and glutamatergic neuronal fates in vertebrate neural tubes .