Pramlintide

Immunogen Synthetic peptide directed towards the middle region of human PRDM15 Sequence Synthetic peptide located within the following region: LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP Physical form Purified antibody supplied in 1x

Immunogen Antibody was raised against a 17 amino acid synthetic peptide from near the carboxy terminus of human PRDM16. Features and Benefits Evaluate our antibodies with complete peace of mind.

Anti-PRDM4 PR domain containing 4, 100ul UN 1687 6.1 PG2

Immunogen Peptide with sequence CSAVYSADESLSAHK from the C Terminus of the protein sequence according to NP_036538. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the middle region of human PRDM9 Biochem/physiol Actions The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often

Anti-PRDX6 peroxiredoxin 6, 100ul UN 1687 6.1 PG2

General description Major prion protein (UniProt P04156: also known as ASCR, CD230, PrP, PrP27-30, PrP33-35C) is encoded by the PRNP (also known as ALTPRP, CJD, GSD, HDL1, KURU, PRIP, PRP, SENF) gene (Gene ID 5621) in human. The major prion

ANTI-PRK2/PKN2 ANTIBODY CLONE 5O2G6 RABBIT MONOCLONAL

Anti-PRKD2 protein kinase D2, 100ul UN 1687 6.1 PG2

Anti-PRKD2 protein kinase D2, 100ul UN 1687 6.1 PG2

Anti-PRKD2 protein kinase D2, 25ul UN 1687 6.1 PG2

General description This gene encodes a member of the cAMP-dependent serine/threonine protein kinase family. This gene is located on chromosome Y, near the boundary of the pseudoautosomal region.