Vildagliptin

Immunogen Peptide with sequence RPQEELEPGIHK, from the internal region of the protein sequence according to NP_073562.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Anti-LEPROT leptin receptor overlapping transcript, 100ul UN

General description VDR (vitamin D receptor) or vitamin D3 receptor is a member of the steroid and thyroid hormone receptors superfamily of trans-acting transcriptional regulatory factors. It is an intracellular polypeptide of 50-60 kDa.

Specificity This antibody reacts to human Vimentin. It may also react to mouse or rat Vimentin, as predicted by immunogen homology.

Specificity This antibody reacts to human Vimentin. It may also react to mouse or rat Vimentin, as predicted by immunogen homology.

General description Anti-Vitamin D Receptor Antibody detects endogenous levels of total Vitamin D Receptor protein. Vitamin D receptor (VDR) gene codes for a nuclear receptor.

Immunogen Synthetic peptide directed towards the middle region of human YTHDF1 Sequence Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA Physical form Purified antibody supplied in 1x

Application Reagent for the FITC labeling of proteins Microsequencing of proteins and peptides (HPLC)

Immunotag™ Human NPYR5 (Neuropeptide Y Receptor Y5) ELISA

InformationVildagliptin (LAF-237) Vildagliptin (LAF-237) inhibits DPP−4 with IC50 of 2.3 nM.In vitroVildagliptin is the most stable DPP-IV inhibitor, binding in the S1- and S2-catalytic sites of DPP-IV, possessing a P-1 site transition-state

VIOS 250i SST IR 1-21 O2 120

An apigenin flavone C-glycoside isolated from various tropical plant species that demonstrates broad antioxidant, anti-inflammatory, anticancer, and antinociceptive activities.