Zopolrestat

Immunogen Synthetic peptide directed towards the N terminal region of human ZFP42 Biochem/physiol Actions ZFP42, also known as REX1 and ZNF754, is a zinc finger protein and a marker of pluripotent stem cells. It is expressed in placenta during

Immunogen The immunogen for anti-ZFP583 antibody: synthetic peptide derected towards the middle region of human ZFP583 Biochem/physiol Actions Zfp583 may be involved in transcriptional regulation. Sequence Synthetic peptide located within the

Immunogen Synthetic peptide directed towards the middle region of human ZFPM1 Biochem/physiol Actions ZFPM1 is a transcription regulator that plays an essential role in erythroid and megakaryocytic cell differentiation. ZFPM1 is an essential

Immunogen The immunogen for anti-ZFR antibody: synthetic peptide derected towards the N terminal of human ZFR Sequence Synthetic peptide located within the following region: ICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGV Physical form

Immunogen Synthetic peptide directed towards the N terminal region of human ZFX Biochem/physiol Actions ZFX is a probable transcriptional activator. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human Zfy2 Biochem/physiol Actions Zfy2 is a probable transcriptional activator. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the C terminal region of mouse ZHX2 Biochem/physiol Actions ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only

Immunogen Synthetic peptide directed towards the N terminal region of human ZMAT3 Application Anti-ZMAT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen Synthetic peptide directed towards the middle region of human ZNF205 Biochem/physiol Actions ZNF205 may be involved in transcriptional regulation. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the N terminal region of human ZNF313 Biochem/physiol Actions ZNF313 may play a role in spermatogenesis Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the N terminal region of human ZNF326 Biochem/physiol Actions ZNF326 is a candidate transcription factor. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human ZNF528 Biochem/physiol Actions ZNF528 may be involved in transcriptional regulation. Sequence Synthetic peptide located within the following region: