-
Add to Cart The item has been addedSAB2501573-100UGANTI-ACADVL (N-TERMINAL) ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence DKSDSHPSDALTRK-C, from the N-Terminus (near) of the protein sequence according to NP_000009.1: NP_001029031. -
Add to Cart The item has been addedHPA038241-100ULANTI-ACAN (C005B-210673)
Price: $1,013.20List Price: $1,125.78Immunogen aggrecan Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA038242-100ULANTI-ACAN (C005B-210674)
Price: $1,013.20List Price: $1,125.78Immunogen aggrecan Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedSAB1303744-400ULANTI-ACAP3 (N-TERM)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedHPA049317-100ULANTI-ACAP3 ANTIBODY PRODUCED IN RABBIT (C005B-215274)
Price: $1,013.20List Price: $1,125.78Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedSAB2501575-100UGANTI-ACAT1 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1 Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB4501646-100UGANTI-ACAT1 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-ACAT1 Antibody detects endogenous levels of total ACAT1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ACAT1. -
Add to Cart The item has been addedSAB5702063-100ULANTI-ACAT2 ANTIBODY CLONE 6Z5L1 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-ACAT2 ANTIBODY CLONE 6Z5L1 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB2107287-100ULANTI-ACBD3 (C005B-330562)
Price: $963.62List Price: $1,070.69Immunogen The immunogen for anti-ACBD3 antibody: synthetic peptide derected towards the middle region of human ACBD3 Sequence Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL Physical -
Add to Cart The item has been addedHPA051772-100ULANTI-ACBD4 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen acyl-CoA binding domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA012145-100ULANTI-ACBD5 (C005B-203614)
Price: $959.88List Price: $1,066.53Immunogen Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedSAB2100023-100ULANTI-ACBD5 (C005B-331834)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the C terminal region of human ACBD5 Biochem/physiol Actions ACBD5 contains 1 ACB (acyl-CoA-binding) domain. Sequence Synthetic peptide located within the following region:
