Immunomodulating drugs

Immunogen ADAMTS-like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen a 20 amino acid peptide from near the carboxy-terminus of human ADAP. Linkage The action of this antibody can be blocked using blocking peptide SBP4277 .

Immunogen a 17 amino acid peptide from near the amino-terminus of human ADAP. Linkage The action of this antibody can be blocked using blocking peptide SBP4279 .

The adhesion and degranulation adaptor protein (ADAP) acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. ADAP modulates the expression of interleukin-2 (IL-2) and it is suggested to be involved in platelet activation.

Immunogen Arf-GAP with dual PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Sequence PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE Application All Prestige

Immunogen Arf-GAP with dual PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

The gene adenosine deaminase, RNA specific (ADAR)/ ADAR1, spanning ~30Kbp on genomic DNA, is mapped to human chromosome 1q21.3.

General description Adenosine deaminase that acts in RNA (ADAR) exists in two isoforms namely, ADAR1 and ADAR2, in mammals. Both the isoforms are expressed in variety of tissues but in general, the pre-mRNA being edited represents receptors of the

General description Anti-ADAR1 Antibody detects endogenous levels of total ADAR1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ADAR1.

Immunogen ADCK2 (NP_443085.2, 1 a.

The gene ADCK2 (uncharacterized aarF domain-containing protein kinase 2) is mapped to human chromosome 7q34. It associates with the molecules of CoQ10 (coenzyme Q10) biosynthesis pathway.

Specificity The antibody detects endogenous levels of total ADCY1 protein. Immunogen Synthetic peptide corresponding to a region derived from internal residues of human adenylate cyclase 1 (brain) Features and Benefits Evaluate our antibodies