Immunomodulating drugs

General description Anti-ADORA1 Antibody detects endogenous levels of total ADORA1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ADORA1.

Immunogen Recombinant protein corresponding to adenosine A2a receptor Sequence PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen ADORA2A (AAH13780.1, 1 a.

Immunogen Peptide with sequence HELKGVCPEPPGLDD, from the C-terminal region of the protein sequence according toNP_000666.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic 16 amino acid peptide from internal region of human Adenosine A2b Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%): Monkey, Marmoset, Horse (94%): Rabbit (88%): Dog (81%).

General description Anti-ADORA3 Antibody detects endogenous levels of total ADORA3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ADORA3.

Immunogen ADP-dependent glucokinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ADP-dependent glucokinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

General description Anti-ADPGK Antibody detects endogenous levels of total ADPGK protein. Immunogen The antiserum was produced against synthesized peptide derived from human ADPGK.

Immunogen ADP-ribosylhydrolase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen ADP-ribosylhydrolase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Magnesium-dependent ADP-ribose/CDP-alcohol diphosphatase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)