Immunomodulating drugs

Immunogen Antibody was raised against a 19 amino acid peptide near the amino terminus of human AFAP1L1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen actin filament associated protein 1-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Anti-AFAP1L2 Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user.

Immunogen Synthetic peptide directed towards the N terminal of human AFF1 Sequence Synthetic peptide located within the following region: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG Physical form Purified antibody supplied in 1x PBS

Immunogen AF4/FMR2 family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen AF4/FMR2 family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Anti-AFP Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user.

General description Anti-AFP, mouse monoclonal, clone 1G7, recognizes ~70-75 kDa AFP protein in HepG2 cells. It is validated for ELISA, Western blotting, and immunocytochemistry.

Immunogen aftiphilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen aftiphilin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) belongs to the group of proteins called AZAPs that contain a catalytic core of PH (pleckstrin homology), Arf GAP and two or more ankyrin repeat domains. The AZAP family is

AGAP3 (ADP ribosylation factor GTPase activating protein (Arf-GAP) with GTPase, ankyrin (ANK) repeat and pleckstrin homology domain (PH) domain-containing protein 3) is a guanosine triphosphatase (GTPase) which contains a nuclear localization