-
Add to Cart The item has been addedHPA072123-100ULANTI-ADPRHL1 ANTIBODY PRODUCED IN RABBIT (C005B-221388)
Price: $1,066.53List Price: $1,185.03Immunogen ADP-ribosylhydrolase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA023820-100ULANTI-ADPRM (C005B-206234)
Price: $959.88List Price: $1,066.53Immunogen Magnesium-dependent ADP-ribose/CDP-alcohol diphosphatase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA026641-100ULANTI-ADPRS ANTIBODY PRODUCED IN RABBIT
Price: $1,066.53List Price: $1,185.03Immunogen ADP-ribosylhydrolase like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedSAB5703027-100ULANTI-ADRA1A ANTIBODY CLONE 4G10W8 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-ADRA1A ANTIBODY CLONE 4G10W8 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB4500530-100UGANTI-ADRA1A ANTIBODY PRODUCED IN RABBIT (C005B-324687)
Price: $946.78List Price: $1,051.98General description Anti-ADRA1A Antibody detects endogenous levels of total ADRA1A protein. Immunogen The antiserum was produced against synthesized peptide derived from human ADRA1A. -
Add to Cart The item has been addedHPA074416-100ULANTI-ADRA1B (C005B-221772)
Price: $1,013.20List Price: $1,125.78Immunogen adrenoceptor alpha 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038789-100ULANTI-ADRA1D (C005B-210960)
Price: $1,013.20List Price: $1,125.78Immunogen adrenergic, alpha-1D-, receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedSAB2500033-100UGANTI-ADRA2A ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-TERRPNGLGPERS from the internal region of the protein sequence according to NP_000672.2. -
Add to Cart The item has been addedHPA066029-100ULANTI-ADRA2B ANTIBODY PRODUCED IN RABBIT (C005B-220253)
Price: $1,013.20List Price: $1,125.78Immunogen adrenoceptor alpha 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA074948-100ULANTI-ADRA2B ANTIBODY PRODUCED IN RABBIT (C005B-221862)
Price: $1,066.53List Price: $1,185.03Immunogen adrenoceptor alpha 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedSAB2500034-100UGANTI-ADRB1 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence ESDEARRCYNDPK from the internal region of the protein sequence according to NP_000675.1. -
Add to Cart The item has been addedSAB2108643-100ULANTI-ADRB2 (C005B-330228)
Price: $894.39List Price: $993.76Immunogen Synthetic peptide directed towards the middle region of human ADRB2 Sequence Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN Physical form Purified antibody supplied in 1x
