-
Add to Cart The item has been addedSAB2500041-100UGANTI-AIF1/IBA1 (ISOFORMS 1 AND 3) (AB1) ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-TGPPAKKAISELP from the C Terminus of the protein sequence according to NP_116573.1: NP_001614. -
Add to Cart The item has been addedSAB5701363-100ULANTI-AIF1/IBA1 ANTIBODY PRODUCED IN RABBIT
Price: $758.66List Price: $842.95Immunogen A synthesized peptide derived from Mouse AIF1/AIF1/IBA1 Physical form Buffer: PBS with 0.02% sodium azide,0. -
Add to Cart The item has been addedHPA020522-100ULANTI-AIF1L ANTIBODY PRODUCED IN RABBIT (C005B-205387)
Price: $959.88List Price: $1,066.53Immunogen allograft inflammatory factor 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056852-100ULANTI-AIF1L ANTIBODY PRODUCED IN RABBIT (C005B-217783)
Price: $1,013.20List Price: $1,125.78Immunogen allograft inflammatory factor 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA030611-100ULANTI-AIFM1 ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Immunogen apoptosis-inducing factor, mitochondrion-associated, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA042309-100ULANTI-AIFM2 (C005B-212624)
Price: $1,013.20List Price: $1,125.78Immunogen apoptosis-inducing factor, mitochondrion-associated, 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedSAB2100080-100ULANTI-AIFM2 (C005B-331816)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human AIFM2 Sequence Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB4503389-100UGANTI-AIFM2 ANTIBODY PRODUCED IN RABBIT (C005B-323060)
Price: $946.78List Price: $1,051.98General description Anti-AIFM2 Antibody detects endogenous levels of total AIFM2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human AIFM2. -
Add to Cart The item has been addedSAB3500713-100UGANTI-AIG1 ANTIBODY PRODUCED IN RABBIT (C005B-327726)
Price: $963.62List Price: $1,070.69Immunogen Antibody was raised against a 17 amino acid peptide near the amino terminus of human AIG1. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB1304597-400ULANTI-AIG1 (N-TERM)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedHPA030948-100ULANTI-AIM1 ANTIBODY PRODUCED IN RABBIT (C005B-208532)
Price: $959.88List Price: $1,066.53Immunogen absent in melanoma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA030948-100Anti-AIM1 absent in melanoma 1, 100ul UN 1687 6.1 PG2 (C003B-078651)
Price: $1,045.96List Price: $1,162.18Anti-AIM1 absent in melanoma 1, 100ul UN 1687 6.1 PG2
