-
Add to Cart The item has been addedSAB1410375-100UGANTI-ALKBH3 ANTIBODY PRODUCED IN RABBIT
Price: $980.46List Price: $1,089.40General description The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. -
Add to Cart The item has been addedHPA051422-100ULANTI-ALKBH4 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 4 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedSAB1407587-50UGANTI-ALKBH5 (C005B-335184)
Price: $980.46List Price: $1,089.40Immunogen ALKBH5 (NP_060228.2, 1 a. -
Add to Cart The item has been addedHPA073835-100ULANTI-ALKBH6 (C005B-221665)
Price: $1,013.20List Price: $1,125.78Immunogen alkB homolog 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA074340-100ULANTI-ALKBH6 (C005B-221755)
Price: $1,013.20List Price: $1,125.78Immunogen alkB homolog 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA039872-100ULANTI-ALKBH7 (C005B-211436)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 7 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA008539-100ULANTI-ALKBH7 ANTIBODY PRODUCED IN RABBIT (C005B-203071)
Price: $1,066.53List Price: $1,185.03Immunogen alkB homolog 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedAV41106-100ULANTI-ALKBH8
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human ALKBH8 Sequence Synthetic peptide located within the following region: MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedHPA038725-100ULANTI-ALKBH8 (C005B-210932)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 8 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA064819-100ULANTI-ALOX12 ANTIBODY PRODUCED IN RABBIT (C005B-219993)
Price: $1,066.53List Price: $1,185.03Immunogen arachidonate 12-lipoxygenase, 12S type Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA024002-100ULANTI-ALOX12B (C005B-206307)
Price: $959.88List Price: $1,066.53Immunogen Arachidonate 12-lipoxygenase, 12R type recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedSAB1410452-100UGANTI-ALOX15 ANTIBODY PRODUCED IN RABBIT (C005B-476776)
Price: $980.46List Price: $1,089.40Immunogen ALOX15 (AAH29032.1, 1 a.
