Immunomodulating drugs

Anti-AP1AR adaptor-related protein complex 1 associated regu

Anti-AP1AR adaptor-related protein complex 1 associated regu

Immunogen Synthetic peptide from human AP1G1 / Gamma Adaptin. Features and Benefits Evaluate our antibodies with complete peace of mind.

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

This affinity purified antibody has been tested for use in ELISA and by western blot.  Specific conditions for reactivity should be optimized by the end user.

Immunogen Synthetic peptide of human AP2A1 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

General description This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin

Immunogen Synthetic peptide directed towards the C terminal region of human AP2B1 Biochem/physiol Actions AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles.

Immunogen Recombinant protein corresponding to adaptor related protein complex 2 beta 1 subunit Sequence PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen AP2M1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human AP2M1. Features and Benefits Evaluate our antibodies with complete peace of mind.

The gene AP2M1 (adaptor related protein complex 2 &#956 1 subunit) is mapped to human chromosome 3q27.1.

Specificity The antibody detects endogenous levels of total AP2S1 protein. Immunogen Full length fusion protein Features and Benefits Evaluate our antibodies with complete peace of mind.