Immunomodulating drugs

DNA dC->dU-editing enzyme APOBEC-3G (APOBEC3G) is a member of the cytidine and deoxycytidylate deaminase family. APOBEC3G is a multi-isoform member of the cytidine deaminase family of enzymes that act on monomeric nucleoside and nucleotide

Immunogen apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Putative C-&gtU-editing enzyme APOBEC-4 recombinant protein epitope signature tag (PrEST) Sequence YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC

Immunogen Putative C->U-editing enzyme APOBEC-4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

General description Anti-APOBEC4 Antibody detects endogenous levels of total APOBEC4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human APOBEC4.

Immunogen apolipoprotein B receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen apolipoprotein C-I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Peptide with sequence CETFQKVKEKLKIDS, from the C Terminus of the protein sequence according to NP_001636.1.

Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of Apolipoprotein D according to NP_001638 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers,

Physical form Supplied in PBS with 0.09% (W/V) sodium azide Disclaimer Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for

General description Anti-APOF Antibody detects endogenous levels of total APOF protein. Immunogen The antiserum was produced against synthesized peptide derived from human APOF.

Immunogen Peptide with sequence C-PSIPTFATLRVYK, from the internal region of the protein sequence according toNP_000033.2 Features and Benefits Evaluate our antibodies with complete peace of mind.