Immunomodulating drugs

Immunogen The immunogen for anti-AQP4 antibody: synthetic peptide derected towards the C terminal of human AQP4 Sequence Synthetic peptide located within the following region: QQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVL Physical form

AQP6 (aquaporin 6) is a membrane protein residing in the intracellular vesicles. It resides in the human inner ear, and the renal collecting ducts in the acid-secreting intercalated cells.

Aquaporin 8 (AQP8) belongs to the water channel proteins, aquaporins (AQPs). The protein is expressed in human pancreas and colon.

Immunogen Recombinant protein corresponding to aquaporin 9 Sequence IEIHHPEPDSVFKAEQSEDKPEKYELSVI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide of human AQP9 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen aquarius intron-binding spliceosomal factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Anti-AQP2 Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user.

Specificity Aquaporin 2 (AQP-CD/WCH-CD). SPECIES REACTIVITY: The antibody has not yet been tested for cross-reactivity to other species.

General description Anti-Aquaporin 2 Antibody detects endogenous levels of total Aquaporin 2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human Aquaporin 2.

Anti-Aquaporin 2 pS261 antibody is suitable for use in ELISA, Western Blotting. Specific conditions for reactivity should be optimized by the end user.

Anti-Aquaporin 2 pS264 antibody is suitable for use in ELISA, Western Blotting. Specific conditions for reactivity should be optimized by the end user.

Anti-Aquaporin 2 pS269 antibody is suitable for use in ELISA, Western Blotting. Specific conditions for reactivity should be optimized by the end user.