Immunomodulating drugs

ANTI-ATGL/PNPLA2 ANTIBODY CLONE 10Y4M10 RABBIT MONOCLONAL

General description KLH-conjugated linear peptide corresponding to 19 amino acids from within the bHLH domain. Application Immunocytochemistry Analysis: A 1:500 dilution from a representative lot detected ATH 5 in SH-SY5Y cells.

Immunogen protein-glucosylgalactosylhydroxylysine glucosidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen protein-glucosylgalactosylhydroxylysine glucosidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen atlastin GTPase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen atlastin GTPase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen atlastin GTPase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Ataxia-telangiectasia (A-T) is a rare human autosomal recessive disease with a pleiotropic phenotype characterized by cerebellar degeneration, oculocutaneous telangiectasias, immune dysfunction, genomic instability, cancer predisposition, radiation

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts