-
Add to Cart The item has been addedHPA006550-100ULANTI-ARPC3 (C005B-202614)
Price: $959.88List Price: $1,066.53Immunogen Actin-related protein 2/3 complex subunit 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA040513-100ULANTI-ARPIN ANTIBODY PRODUCED IN RABBIT (C005B-211726)
Price: $1,066.53List Price: $1,185.03Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047173-100ULANTI-ARPIN ANTIBODY PRODUCED IN RABBIT (C005B-214564)
Price: $1,013.20List Price: $1,125.78Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA052278-100ULANTI-ARPIN ANTIBODY PRODUCED IN RABBIT (C005B-216320)
Price: $1,013.20List Price: $1,125.78Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB1408108-50UGANTI-ARPM1
Price: $980.46List Price: $1,089.40Immunogen ARPM1 (AAH07289.1, 1 a. -
Add to Cart The item has been addedHPA063129-100ULANTI-ARR3 (C005B-219546)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to arrestin 3 Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedSAB4502516-100UGANTI-ARRDC3 ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-ARRDC3 Antibody detects endogenous levels of total ARRDC3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ARRDC3. -
Add to Cart The item has been addedSAB2500117-100UGANTI-ARRESTIN BETA 2 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-HDHIPLPRPQS from the internal region of the protein sequence according to NP_004304.1: NP_945355. -
Add to Cart The item has been addedHPA037770-100ULANTI-ARSB (C005B-210431)
Price: $1,013.20List Price: $1,125.78Immunogen arylsulfatase B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA037771-100ULANTI-ARSB (C005B-210432)
Price: $1,013.20List Price: $1,125.78Immunogen arylsulfatase B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been added600-401-Y63Anti-ARSB (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-ARSB Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedHPA038386-100ULANTI-ARSI (C005B-210744)
Price: $1,013.20List Price: $1,125.78Immunogen arylsulfatase family, member I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
