Immunomodulating drugs

Physical form Supplied in PBS with 0.09% (W/V) sodium azide Disclaimer Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for

General description Aristaless-related homeobox protein (ARX) is a transcription factor that plays an important role in the development of the brain, testis, and pancreas. The gene targets and nuclear associations of ARX are less clear, although

Immunogen Peptide with sequence C-DDPEKIEERKKSK from the internal region of the protein sequence according to NP_055647.2.

Immunogen Peptide with sequence AALRDAEIQKDVQ-C, from the N-terminal region of the protein sequence according toNP_065733.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen ASAH1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of the human ASAH1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the N terminal region of human ASAH1 Sequence Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY Physical form Purified antibody supplied in

Anti-ASAH1 Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user.

Anti-ASAH2 Antibody has been tested for use in ELISA and Western Blotting. Specific conditions for reactivity should be optimized by the end user. Expect a band at approximately 86 kDa in Western Blots of specific cell lysates and tissues.

Specificity The antibody detects endogenous levels of total ASAH3L protein. Immunogen Synthesized peptide derived from internal of human ASAH3L.

This affinity purified antibody has been tested for use in ELISA, IF microscopy and by western blot.  Specific conditions for reactivity should be optimized by the end user.

Anti-ASAP1 Antibody has been tested for use in ELISA and Western Blot. Expect a band approximately ~125kDa using positive control lysates over-expressing ASAP1, or other specific lysates or tissues.

Immunogen Synthetic peptide directed towards the C terminal region of human ASB11 Sequence Synthetic peptide located within the following region: GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV Physical form Purified antibody supplied in 1x PBS