-
Add to Cart The item has been addedHPA024298-100ULANTI-B3GNT3 (C15-1450-712)
Price: $959.88List Price: $1,066.53Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA055261-100ULANTI-B3GNT4 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA017292-100ULANTI-B3GNT5 (C15-1448-726)
Price: $959.88List Price: $1,066.53B3GNT5 (UDP-GlcNAc: β Gal β-1,3- N -acetylglucosaminyltransferase 5) is a type II membrane protein belonging to the ⓷Gn-T family (⓷Gn-T5). Its three motif sturcture consists of a NH2-terminal cytoplasmic domain, a -
Add to Cart The item has been addedHPA035625-100ULANTI-B3GNT7 (C15-1453-938)
Price: $1,013.20List Price: $1,125.78Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA052743-100ULANTI-B3GNT9 ANTIBODY PRODUCED IN RABBIT (C15-1461-123)
Price: $1,013.20List Price: $1,125.78Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA023585-100ULANTI-B3GNTL1 (C15-1450-446)
Price: $959.88List Price: $1,066.53The gene B3GNTL1 (UDP-GlcNAc:βGal β-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3. -
Add to Cart The item has been addedHPA024547-100ULANTI-B3GNTL1 (C15-1450-796)
Price: $959.88List Price: $1,066.53The gene B3GNTL1 (UDP-GlcNAc:βGal β-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3. -
Add to Cart The item has been addedAV45116-100ULANTI-B4GALNT1 (C15-1341-531)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA015721-100ULANTI-B4GALNT2 (C15-1448-432)
Price: $959.88List Price: $1,066.53Immunogen Beta-1,4 N-acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application Anti-B4GALNT2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA011404-100ULANTI-B4GALNT3 (C15-1447-605)
Price: $959.88List Price: $1,066.53Immunogen N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N- acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA046819-100ULANTI-B4GALT4 ANTIBODY PRODUCED IN RABBIT (C15-1459-016)
Price: $1,013.20List Price: $1,125.78Immunogen UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedSAB4301698-100ULANTI-B4GALT5
Price: $688.57List Price: $765.07Immunogen Fusion protein of human B4GALT5 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.
