Immunomodulating drugs

Immunogen Synthetic peptide directed towards the middle region of human ASCL1 Sequence Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW Physical form Purified antibody supplied in 1x

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Immunogen achaete-scute complex homolog 3 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen achaete-scute complex homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Peptide with sequence C-ENSLNVMLESH from the C Terminus of the protein sequence according to NP_054753.1.

General description Anti-ASF1A Antibody detects endogenous levels of total ASF1A protein. Immunogen The antiserum was produced against synthesized peptide derived from human ASF1A.

Immunogen Peptide with sequence C-EDNTEKLEDAE from the internal region of the protein sequence according to NP_054753.1.

Immunogen A synthesized peptide derived from human ASH2L Physical form Buffer: PBS with 0.02% sodium azide,0.

Immunogen a 16 amino acid peptide from near the carboxy-terminus of human ASK1. Linkage The action of this antibody can be blocked using blocking peptide SBP3677 .

General description Anti-ASK1 Antibody detects endogenous levels of total ASK1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ASK1.

Immunogen N-Acetylserotonin O-methyltransferase-like protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Peptide with sequence PNKHVSVPDR, from the internal region of the protein sequence according to NP_061921.1 Features and Benefits Evaluate our antibodies with complete peace of mind.