Immunomodulating drugs

General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2.

General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2.

General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2.

Immunogen Synthetic peptide directed towards the N terminal region of mouse ATF4 Biochem/physiol Actions Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE&#8242:s as a homodimer. Sequence Synthetic

General description The previously assigned protein identifier Q5U4B2 has been merged into Q06507. Full details can be found on the UniProt database.

Anti-ATF4 Biotin Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues.

Anti-ATF4 PerCP Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues.

Anti-ATF4 R-PE Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues.

Immunogen Synthetic peptide directed towards the N terminal region of human ATF5 Sequence Synthetic peptide located within the following region: MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG Physical form Purified antibody supplied in 1x PBS

Immunogen Cyclic AMP-dependent transcription factor ATF-7 recombinant protein epitope signature tag (PrEST) Application Anti-ATF7 antibody produced in rabbit is suitable for immunoprecipitation and immunostaining of ATF-7. Anti-ATF7 antibody

The gene ATF7IP (activating transcription factor 7 interacting protein), also referred to as MCAF1 (methyl-CpG binding domain protein 1/ MBD1-containing chromatin-associated factor 1) is mapped to human chromosome 12p13. The C-terminal end of the

Immunogen activating transcription factor 7 interacting protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project