-
Add to Cart The item has been added05-559-I-100ULANTI-B-TUBULIN III NEUR CLO 2G10 (C15-1616-183)
Price: $804.99List Price: $894.43Specificity Clone 2G10 is a mouse monoclonal antibody that detects Tubulin beta-III. It targets and epitope within 15 amino acids from the C-terminal region. -
Add to Cart The item has been added05-559-I-25ULANTI-B-TUBULIN III NEUR CLO 2G10 (C15-1616-184)
Price: $335.18List Price: $372.43Specificity Clone 2G10 is a mouse monoclonal antibody that detects Tubulin beta-III. It targets and epitope within 15 amino acids from the C-terminal region. -
Add to Cart The item has been addedSAB2105109-100ULANTI-B2M (C15-1744-441)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human B2M Sequence Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedHPA006361-100Anti-B2M beta-2-microglobulin, 100ul UN 1687 6.1 PG2
Price: $888.55List Price: $987.28Anti-B2M beta-2-microglobulin, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA006361-25Anti-B2M beta-2-microglobulin, 25ul UN 1687 6.1 PG2
Price: $600.64List Price: $667.38Anti-B2M beta-2-microglobulin, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedSAB4503458-100UGANTI-B3GALT2 ANTIBODY PRODUCED IN RABBIT (C15-1735-679)
Price: $946.78List Price: $1,051.98General description Anti-B3GALT2 Antibody detects endogenous levels of total B3GALT2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human B3GALT2. -
Add to Cart The item has been addedAV50258-100ULANTI-B3GALT6
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human B3GALT6 Application Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedSAB4500508-100UGANTI-B3GALTL ANTIBODY PRODUCED IN RABBIT
Price: $946.78List Price: $1,051.98General description Anti-B3GALTL Antibody detects endogenous levels of total B3GALTL protein. Immunogen The antiserum was produced against synthesized peptide derived from human B3GALTL. -
Add to Cart The item has been addedHPA005997-100ULANTI-B3GNT2
Price: $959.88List Price: $1,066.53Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA024298-100ULANTI-B3GNT3 (C15-1450-712)
Price: $959.88List Price: $1,066.53Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA055261-100ULANTI-B3GNT4 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA017292-100ULANTI-B3GNT5 (C15-1448-726)
Price: $959.88List Price: $1,066.53B3GNT5 (UDP-GlcNAc: β Gal β-1,3- N -acetylglucosaminyltransferase 5) is a type II membrane protein belonging to the ⓷Gn-T family (⓷Gn-T5). Its three motif sturcture consists of a NH2-terminal cytoplasmic domain, a
