Immunomodulating drugs

Immunogen BCAS1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human BCAS1. NABC1/BCAS1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human BCAS1.

Immunogen breast carcinoma amplified sequence 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen BCAS2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human BCAS2. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human BCAS3. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen breast carcinoma amplified sequence 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

General description BCAS3 is physically associated with histone H3 and histone acetyltransferase complex protein P/CAF (p300/CBP-associated factor) and possesses histone acetyltransferase activity. In breast cancer, several chromosomal sites

Immunogen BCAS4 antibody was raised against a 14 amino acid peptide near the amino terminus of human BCAS4. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the C terminal of human BCAT1 Sequence Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI Physical form Purified antibody supplied in 1x PBS

General description This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine.

Immunogen branched chain keto acid dehydrogenase E1, alpha polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Synthetic peptide directed towards the N terminal region of human BCKDHA Sequence Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY Physical form Purified antibody supplied in

Immunogen branched chain keto acid dehydrogenase E1, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)