Immunomodulating drugs

Immunogen Synthetic peptide directed towards the N terminal region of human ATG2A Sequence Synthetic peptide located within the following region: PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF Physical form Purified antibody supplied in

Immunogen Antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human ATG2B. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Autophagy-related protein 2 homolog B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

ATG3 is a member of the autophagy-related protein family and is involved in the formation of the autophagosome. Autophagy-related protein 3 (ATG3) is a member of the autophagy-related protein family.

Immunogen autophagy related 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

ATG3 is thought to be an autophagy-related ubiquitin carrier protein (E2)-like enzyme that is the go between for the conjugation on ATG8 and phosphatidylethanolamine (PE). This compound is necessary for autophagy, which is a process in which a cell

General description This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells.

Anti-ATG3 autophagy related 3, 100ul UN 1687 6.1 PG2

Immunogen ATG4 autophagy related 4 homolog A (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen autophagy related 4A, cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ANTI-ATG4B ANTIBODY CLONE 9H6M6 RABBIT MONOCLONAL

General description Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis,