-
Add to Cart The item has been addedSAB4500452-100UGANTI-ATF2 ANTIBODY PRODUCED IN RABBIT (C005B-324736)
Price: $946.78List Price: $1,051.98General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF-2. -
Add to Cart The item has been addedSAB4500449-100UGANTI-ATF2 ANTIBODY PRODUCED IN RABBIT (C005B-324737)
Price: $946.78List Price: $1,051.98General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2. -
Add to Cart The item has been addedSAB4500448-100UGANTI-ATF2 ANTIBODY PRODUCED IN RABBIT (C005B-324738)
Price: $946.78List Price: $1,051.98General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2. -
Add to Cart The item has been addedSAB4500447-100UGANTI-ATF2 ANTIBODY PRODUCED IN RABBIT (C005B-324739)
Price: $946.78List Price: $1,051.98General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2. -
Add to Cart The item has been addedSAB4500446-100UGANTI-ATF2 ANTIBODY PRODUCED IN RABBIT (C005B-324740)
Price: $946.78List Price: $1,051.98General description Anti-ATF2 Antibody detects endogenous levels of total ATF2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATF2. -
Add to Cart The item has been addedSAB2108508-100ULANTI-ATF4 (C005B-330297)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of mouse ATF4 Biochem/physiol Actions Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE′:s as a homodimer. Sequence Synthetic -
Add to Cart The item has been addedSAB2105294-100ULANTI-ATF4 (C005B-330851)
Price: $980.46List Price: $1,089.40General description The previously assigned protein identifier Q5U4B2 has been merged into Q06507. Full details can be found on the UniProt database. -
Add to Cart The item has been added200-306-W61Anti-ATF4 (MOUSE) Monoclonal Antibody Biotin Conjugated, 100 g, Liquid (sterile filtered)
Price: $1,002.56List Price: $1,113.95Anti-ATF4 Biotin Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues. -
Add to Cart The item has been added200-365-W61Anti-ATF4 (MOUSE) Monoclonal Antibody PerCP Conjugated, 100 g, Liquid (sterile filtered)
Price: $1,002.56List Price: $1,113.95Anti-ATF4 PerCP Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues. -
Add to Cart The item has been added200-308-W61Anti-ATF4 (MOUSE) Monoclonal Antibody Phycoerythrin Conjugated, 100 g, Liquid (sterile filtered)
Price: $1,002.56List Price: $1,113.95Anti-ATF4 R-PE Conjugated Antibody is suitable for Western Blots and Immunocytochemistry. Expect a band approximately ~60 kDa on specific lysates or tissues. -
Add to Cart The item has been addedAV100654-100ULANTI-ATF5 (C005B-098381)
Price: $1,021.62List Price: $1,135.14Immunogen Synthetic peptide directed towards the N terminal region of human ATF5 Sequence Synthetic peptide located within the following region: MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedHPA003384-100ULANTI-ATF7 (C005B-201957)
Price: $959.88List Price: $1,066.53Immunogen Cyclic AMP-dependent transcription factor ATF-7 recombinant protein epitope signature tag (PrEST) Application Anti-ATF7 antibody produced in rabbit is suitable for immunoprecipitation and immunostaining of ATF-7. Anti-ATF7 antibody
