Immunomodulating drugs

Immunogen atlastin GTPase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen atlastin GTPase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Ataxia-telangiectasia (A-T) is a rare human autosomal recessive disease with a pleiotropic phenotype characterized by cerebellar degeneration, oculocutaneous telangiectasias, immune dysfunction, genomic instability, cancer predisposition, radiation

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts

Monoclonal Anti-ATM (mouse IgG1 isotype) is derived from the hybridoma MAT3-4G10/8 produced by the fusion of mouse myeloma cells (NSO) and splenocytes from BALB/c mice immunized with a peptide. Specificity Monoclonal Anti-ATM antibody reacts

General description The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates: thus, it functions as a regulator of a wide variety of downstream proteins,

In Arabidopsis thaliana, 20 genes (MPKs) encode putative plant MAPKs, which can be grouped into four or five classes according to sequence similarity. All plant MAPKs are classified into the plant extracellular-regulated kinase/ERK (PERK) subfamily.

Immunogen atrophin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

This protein is a member of the superfamily of ATP-binding cassette (ABC) transporters. There are seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

General description Anti-ATP-Citrate Lyase Antibody detects endogenous levels of total ATP-Citrate Lyase protein. Immunogen The antiserum was produced against synthesized peptide derived from human ATP-Citrate Lyase.