Immunomodulating drugs

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x

Immunogen Beta-1,4 N-acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application Anti-B4GALNT2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project

Immunogen N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N- acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Fusion protein of human B4GALT5 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen Synthetic peptide directed towards the C terminal of human B4GALT6 Biochem/physiol Actions B4galt6 is required for the biosynthesis of glycosphingolipids. Sequence Synthetic peptide located within the following region:

Immunogen xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

B3GNT1 (N-acetyllactosaminide &#946-1,3-N-acetylglucosaminyltransferase) is a glycosyltransferase, which is a member of the B3GNT family. It is a type II transmembrane protein, with its transmembrane region composed of 28 amino acids.

Immunogen Synthetic peptide of human B4GAT1 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

General description B7 homolog 3 (B7-H3 or CD276) is a costimulatory molecule belonging to the B7 family that signals through the CD28 family of molecules, including CD28, CTLA4 and ICOS. B7-H3 may be involved in the regulation of T-cell-mediated