Immunomodulating drugs

General description Anti-BMP8B Antibody detects endogenous levels of total BMP8B protein. Immunogen The antiserum was produced against synthesized peptide derived from human BMP8B.

BMPR-1A (bone morphogenic protein receptor type 1A) signaling is known to be important for inner root sheath differentiation, hair follicle cycling and tooth development. Mutations in BMPR-1A are a common cause of juvenile polyposis syndrome (JPS).

Immunogen bone morphogenetic protein receptor, type II (serine/threonine kinase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

General description BMS1L may act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus. Immunogen BMS1L (NP_055568, 1179-1213) This antibody is generated from rabbits immunized with a KLH conjugated synthetic

General description Anti-BMX Antibody detects endogenous levels of total BMX protein. Immunogen The antiserum was produced against synthesized peptide derived from human BMX.

Immunogen Synthetic peptide directed towards the C terminal of human BNC1 Sequence Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence C-DLLRQRKTTKESLAQ from the internal region of the protein sequence according to NP_001196.1: NP_053581.

Immunogen synthetic peptide corresponding to amino acids 86-95 of human BNIP1 Physical form Solution in 0.01 M phosphate buffered saline, pH 7.

General description This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death.

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) contains protein–protein interaction domain, the BNIP-2 and Cdc42GAP homology (BCH) domain, in the C-terminus. Endogenous BNIP-2 is expressed in Golgi apparatus, early and recycl

ANTI-BNIP3 CLONE 1G21 ZOOMAB« RABBIT MONOCLONAL

ANTI-BNIP3 CLONE 1G21 ZOOMAB« RABBIT MONOCLONAL