Immunomodulating drugs

BAZ2B (Bromodomain adjacent to zinc finger domain, 2B) is a novel member of bromodomain family mapped to chromosome 2q23-q24. It is composed of a carboxy-terminal bromodomain, an adjacent PHD finger, and a WACZ motif.

BROMO domain adjacent to zinc finger 2B (BAZ2B) is a multidomain histone-binding protein. It has two histone reader modules, a plant homeodomain (PHD) and a bromodomain (BRD), connected with the help of a 72-amino acid linker.

Immunogen Peptide with sequence DGGRPQRTVR, from the internal region of the protein sequence according to NP_001120712.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen basal body orientation factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the N terminal of human BBS1 Sequence Synthetic peptide located within the following region: PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI Physical form Purified antibody supplied in 1x PBS

Immunogen Bardet-Biedl syndrome 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Bardet-Biedl syndrome 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen bobby sox homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Physical form Supplied in PBS with 0.09% (W/V) sodium azide Disclaimer Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for

Immunogen BCAN (AAH09117.1, 1 a.

Immunogen BCAP29 (NP_061332.2, 1 a.

Immunogen B-cell receptor-associated protein 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,